PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Neem_4822_f_3
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Meliaceae; Azadirachta
Family MIKC_MADS
Protein Properties Length: 281aa    MW: 33107.8 Da    PI: 9.4251
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Neem_4822_f_3genomeNGDView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF82.52.6e-26959151
                   S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
         SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                   krien + rqvtfskRr+g+lKK +ELSvLCda++ +iifsstgkl  y++
  Neem_4822_f_3  9 KRIENPTTRQVTFSKRRAGLLKKTHELSVLCDAQIGLIIFSSTGKLCQYCT 59
                   79***********************************************96 PP

2K-box69.31.2e-23831661295
          K-box  12 akaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLr 95 
                       e+l +el  L+ke++ Lq + R++ Ge+L+s+ +++L +Leq+Le+s++k+R +Knell +q+++l++ke++l+een ++r
  Neem_4822_f_3  83 DSREQLLNELGVLRKETRHLQLSMRRYTGENLSSIPYEDLDELEQELERSVNKVRGRKNELLQQQLDNLRRKERMLEEENSNIR 166
                    45678999************************************************************************9986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004329.9E-40160IPR002100Transcription factor, MADS-box
PROSITE profilePS5006630.557161IPR002100Transcription factor, MADS-box
CDDcd002651.37E-37276No hitNo description
SuperFamilySSF554556.41E-29279IPR002100Transcription factor, MADS-box
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PRINTSPR004041.1E-27323IPR002100Transcription factor, MADS-box
PfamPF003192.9E-231057IPR002100Transcription factor, MADS-box
PRINTSPR004041.1E-272338IPR002100Transcription factor, MADS-box
PRINTSPR004041.1E-273859IPR002100Transcription factor, MADS-box
PfamPF014864.0E-2281166IPR002487Transcription factor, K-box
PROSITE profilePS5129714.39385179IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 281 aa     Download sequence    Send to blast
MGRGKIEIKR IENPTTRQVT FSKRRAGLLK KTHELSVLCD AQIGLIIFSS TGKLCQYCTE  60
PYRIEQIIKR RTKVTGIRIP EHDSREQLLN ELGVLRKETR HLQLSMRRYT GENLSSIPYE  120
DLDELEQELE RSVNKVRGRK NELLQQQLDN LRRKERMLEE ENSNIRPPDE AKVGRNQLNM  180
RRDNKAYPRH GGLRGCRTCL SAGRVTLCFH ECRTTRERML EEENSNMYRW IQEHRAAMEY  240
QQQILDHFPF CSEQLQTSTV QLQLATNTIP PQIHPYHLQL A
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3kov_A7e-17259158Myocyte-specific enhancer factor 2A
3kov_B7e-17259158Myocyte-specific enhancer factor 2A
3kov_I7e-17259158Myocyte-specific enhancer factor 2A
3kov_J7e-17259158Myocyte-specific enhancer factor 2A
3p57_A7e-17259158Myocyte-specific enhancer factor 2A
3p57_B7e-17259158Myocyte-specific enhancer factor 2A
3p57_C7e-17259158Myocyte-specific enhancer factor 2A
3p57_D7e-17259158Myocyte-specific enhancer factor 2A
3p57_I7e-17259158Myocyte-specific enhancer factor 2A
3p57_J7e-17259158Myocyte-specific enhancer factor 2A
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006437607.11e-112hypothetical protein CICLE_v10032489mg
SwissprotQ9ATE56e-70FBP24_PETHY; MADS-box protein FBP24
TrEMBLV4TC411e-112V4TC41_9R
STRINGVIT_10s0042g00820.t011e-83(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM65062543
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G23260.21e-59MIKC_MADS family protein